Native Human IFNA1 Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IFNA1-086THP |
| Common Name: |
IFNA1 |
| Product Name: |
Native Human IFNA1 Protein, GMP Grade |
| Product Overview: |
Native Human IFNA1 Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia. |
| Species: |
Human |
| Bio-activity: |
5000000 [arb'U]/1mL |
| Molecular Mass: |
Not Available |
| AA Sequence: |
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKECDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKECDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRRDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Applications: |
For the intralesional treatment of refractory or recurring external condylomata acuminata. |
| Usage: |
Refractory or recurring external condylomata acuminata. |
| Gene Name: |
IFNA1 interferon, alpha 1 [ Homo sapiens (human) ] |
| Official Symbol: |
IFNA1 |
| Synonyms: |
IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507; |
| GeneID: |
3439 |
| mRNA Refseq: |
NM_024013 |
| Protein Refseq: |
NP_076918 |
| MIM: |
147660 |
| UniProt ID: |
P01562 |
Not For Human Consumption!
