Native Human SERPINA1 Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
SERPINA1-078THP |
| Common Name: |
SERPINA1 |
| Product Name: |
Native Human SERPINA1 Protein, GMP Grade |
| Product Overview: |
Native Human SERPINA1 Protein was purified from human plasma and was produced in an animal component free process under cGMP guidelines. |
| Description: |
The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. |
| Source: |
human plasma |
| Species: |
Human |
| Bio-activity: |
25 mg/mL |
| Molecular Mass: |
44324.5 Da |
| AA Sequence: |
EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For chronic augmentation and maintenance therapy in individuals with alpha1-proteinase inhibitor (A1-PI) deficiency and clinical evidence of emphysema. |
| Usage: |
Alpha1-proteinase inhibitor (A1-PI) deficiency |
| Storage: |
Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 centigrade for 1 week. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Gene Name: |
SERPINA1 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 [ Homo sapiens (human) ] |
| Official Symbol: |
SERPINA1 |
| Synonyms: |
SERPINA1; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; PI, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 1; alpha-1-antitrypsin; A1A; A1AT; AAT; alpha 1 antitrypsin; alpha1AT; PI1; protease inhibitor 1 (anti elastase); serpin A1; alpha-1-antiproteinase; alpha-1-antitrypsin null; alpha-1 protease inhibitor; protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin; serine (or cysteine) proteinase inhibitor, clade A, member 1; PI; PRO2275; MGC9222; MGC23330; |
| GeneID: |
5265 |
| mRNA Refseq: |
NM_000295 |
| Protein Refseq: |
NP_000286 |
| MIM: |
107400 |
| UniProt ID: |
P01009 |
Not For Human Consumption!
