Cat# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
Insulin-150THP | Native Pig Insulin Protein, GMP Grade | 10ug | $998.00 |
|
|
Quote Order Bulk Order |
Cat#: | Insulin-150THP |
Common Name: | Insulin |
Product Name: | Native Pig Insulin Protein, GMP Grade |
Product Overview: | Native Pig Insulin Protein was purified from Pig Pancreas and was produced under cGMP guidelines. |
Source: | Pig Pancreas |
Species: | Pig |
Bio-activity: | 100 IU/ml |
Molecular Mass: | 5795.6 Da |
AA Sequence: | GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Endotoxin: | <0.001 EU/μg of the peptide by the LAL method |
Applications: | For the treatment of type I and II diabetes mellitus. |
Usage: | Type 1 or 2 diabetes mellitus |
Official Symbol: | Insulin |
Synonyms: | Insulin |
Catalog# | Product Name | Inquiry |
---|---|---|
Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools