Native Pig Insulin Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Insulin-150THP |
| Common Name: |
Insulin |
| Product Name: |
Native Pig Insulin Protein, GMP Grade |
| Product Overview: |
Native Pig Insulin Protein was purified from Pig Pancreas and was produced under cGMP guidelines. |
| Source: |
Pig Pancreas |
| Species: |
Pig |
| Bio-activity: |
100 IU/ml |
| Molecular Mass: |
5795.6 Da |
| AA Sequence: |
GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Applications: |
For the treatment of type I and II diabetes mellitus. |
| Usage: |
Type 1 or 2 diabetes mellitus |
| Official Symbol: |
Insulin |
| Synonyms: |
Insulin |
Not For Human Consumption!
