Native Pig Insulin Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
Insulin-150THP Native Pig Insulin Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  Insulin-150THP
Common Name:  Insulin
Product Name:  Native Pig Insulin Protein, GMP Grade
Product Overview:  Native Pig Insulin Protein was purified from Pig Pancreas and was produced under cGMP guidelines.
Source:  Pig Pancreas
Species:  Pig
Bio-activity:  100 IU/ml
Molecular Mass:  5795.6 Da
AA Sequence:  GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Applications:  For the treatment of type I and II diabetes mellitus.
Usage:  Type 1 or 2 diabetes mellitus
Official Symbol:  Insulin
Synonyms:  Insulin
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.