Native Pig Insulin Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Insulin-150THP |
| Common Name: |
Insulin |
| Product Name: |
Native Pig Insulin Protein, GMP Grade |
| Product Overview: |
Native Pig Insulin Protein was purified from Pig Pancreas and was produced under cGMP guidelines. |
| Source: |
Pig Pancreas |
| Species: |
Pig |
| Bio-activity: |
100 IU/ml |
| Molecular Mass: |
5795.6 Da |
| AA Sequence: |
GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Applications: |
For the treatment of type I and II diabetes mellitus. |
| Usage: |
Type 1 or 2 diabetes mellitus |
| Official Symbol: |
Insulin |
| Synonyms: |
Insulin |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
