Native Porcine Pepsin Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Pepsin-170THP |
| Common Name: |
Pepsin |
| Product Name: |
Native Porcine Pepsin Protein, GMP Grade |
| Product Overview: |
Native Porcine Pepsin Protein without tag was produced under cGMP guidelines. |
| Species: |
Porcine |
| Bio-activity: |
100 mg/30 mL |
| Molecular Mass: |
Not Available |
| AA Sequence: |
MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Applications: |
Used as a pancreatic enzyme replacement in pancreatic insufficiency. The product powder is prepared from the gastric mucosa of pigs, cattle or sheep. In the laboratory, it is primarily used for the unspecific hydrolysis of proteins and peptides in acidic media. In addition, it provides limited hydrolysis of native immunoglobulins, yielding biologically active fragments.In certain supplements, the product may be combined with betaine and HCl (hydrochloric acid) to aid in digestion in various gastrointestinal conditions. |
| Usage: |
Pancreatic insufficiency |
| Official Symbol: |
Pepsin |
| Synonyms: |
Pepsin |
Not For Human Consumption!
