Recombinant Agkistrodon contortrix Fibrolase Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Fibrolase-131THP |
| Common Name: |
Fibrolase |
| Product Name: |
Recombinant Agkistrodon contortrix Fibrolase Protein, GMP Grade |
| Product Overview: |
Recombinant Agkistrodon contortrix Fibrolase Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Agkistrodon contortrix |
| Molecular Mass: |
Not Available |
| AA Sequence: |
SFPQRYVQLVIVADHRMNTKYNGDSDKIRQWVHQIVNTINEIYRPLNIQFTLVGLEIWSNQDLITVTSVSHDTLASFGNWRETDLLRRQRHDNAQLLTAIDFDGDTVGLAYVGGMCQLKHSTGVIQDHSAINLLVALTMAHELGHNLGMNHDGNQCHCGANSCVMAAMLSDQPSKLFSDCSKKDYQTFLTVNNPQCILNKP |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
The product is being evaluated as a potential treatment for acute ischemic stroke, catheter occlusion (CO) and acute peripheral arterial occlusion (PAO). |
| Usage: |
Acute ischemic stroke, catheter occlusion (CO) and acute peripheral arterial occlusion (PAO) |
| Storage: |
Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 centigrade for 1 week. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Official Symbol: |
Fibrolase |
| Synonyms: |
Fibrolase |
Not For Human Consumption!
