Recombinant Agkistrodon contortrix Fibrolase Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
Fibrolase-131THP Recombinant Agkistrodon contortrix Fibrolase Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  Fibrolase-131THP
Common Name:  Fibrolase
Product Name:  Recombinant Agkistrodon contortrix Fibrolase Protein, GMP Grade
Product Overview:  Recombinant Agkistrodon contortrix Fibrolase Protein without tag was produced in an animal component free process under cGMP guidelines.
Species:  Agkistrodon contortrix
Molecular Mass:  Not Available
AA Sequence:  SFPQRYVQLVIVADHRMNTKYNGDSDKIRQWVHQIVNTINEIYRPLNIQFTLVGLEIWSNQDLITVTSVSHDTLASFGNWRETDLLRRQRHDNAQLLTAIDFDGDTVGLAYVGGMCQLKHSTGVIQDHSAINLLVALTMAHELGHNLGMNHDGNQCHCGANSCVMAAMLSDQPSKLFSDCSKKDYQTFLTVNNPQCILNKP
Endotoxin:  <0.1 EU/μg of the protein by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  The product is being evaluated as a potential treatment for acute ischemic stroke, catheter occlusion (CO) and acute peripheral arterial occlusion (PAO).
Usage:  Acute ischemic stroke, catheter occlusion (CO) and acute peripheral arterial occlusion (PAO)
Storage:  Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 centigrade for 1 week. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Official Symbol:  Fibrolase
Synonyms:  Fibrolase
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.