Recombinant Aspergillus flavus Urate-oxidase enzyme Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Urate-oxidase enzyme-179THP |
| Common Name: |
Urate-oxidase enzyme |
| Product Name: |
Recombinant Aspergillus flavus Urate-oxidase enzyme Protein, GMP Grade |
| Product Overview: |
Recombinant Aspergillus flavus Urate-oxidase enzyme Protein without tag was expressed in Saccharomyces cerevisiae and was produced in an animal component free process under cGMP guidelines. |
| Source: |
Saccharomyces cerevisiae |
| Species: |
Aspergillus flavus |
| Bio-activity: |
7.5 mg/5mL |
| Molecular Mass: |
34109.5 Da |
| AA Sequence: |
SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSKL |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Usage: |
Hyperuricemia |
| Official Symbol: |
Urate-oxidase enzyme |
| Synonyms: |
Urate-oxidase enzyme |
Not For Human Consumption!
