Recombinant Human ACVR2A Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
ACVR2A-120THP Recombinant Human ACVR2A Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  ACVR2A-120THP
Common Name:  ACVR2A
Product Name:  Recombinant Human ACVR2A Protein, GMP Grade
Product Overview:  Recombinant Human ACVR2A Protein without tag was produced in an animal component free process under cGMP guidelines.
Description:  This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.
Species:  Human
Molecular Mass:  77829.47 Da
AA Sequence:  ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin:  <0.1 EU/μg of the protein by the LAL method
Applications:  Sotatercept has been used in trials studying the supportive care and treatment of Anemia, Leukemia, Solid Tumors, Bladder Cancer, and multiple myeloma, among others.
Usage:  Anemia; Chronic Myelomonocytic Leukemia; Chronic Myelomonocytic Leukemia (CMML); Low to Intermediate-1 MDS; Myelodysplastic Syndromes (MDS)
Gene Name:  ACVR2A activin A receptor, type IIA [ Homo sapiens (human) ]
Official Symbol:  ACVR2A
Synonyms:  ACVR2A; activin A receptor, type IIA; activin A receptor, type II , ACVR2; activin receptor type-2A; ACTRII; ACVR2;
GeneID:  92
mRNA Refseq:  NM_001616
Protein Refseq:  NP_001607
MIM:  102581
UniProt ID:  P27037
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.