Recombinant Human ACVR2A Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
ACVR2A-120THP |
| Common Name: |
ACVR2A |
| Product Name: |
Recombinant Human ACVR2A Protein, GMP Grade |
| Product Overview: |
Recombinant Human ACVR2A Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene. |
| Species: |
Human |
| Molecular Mass: |
77829.47 Da |
| AA Sequence: |
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Applications: |
Sotatercept has been used in trials studying the supportive care and treatment of Anemia, Leukemia, Solid Tumors, Bladder Cancer, and multiple myeloma, among others. |
| Usage: |
Anemia; Chronic Myelomonocytic Leukemia; Chronic Myelomonocytic Leukemia (CMML); Low to Intermediate-1 MDS; Myelodysplastic Syndromes (MDS) |
| Gene Name: |
ACVR2A activin A receptor, type IIA [ Homo sapiens (human) ] |
| Official Symbol: |
ACVR2A |
| Synonyms: |
ACVR2A; activin A receptor, type IIA; activin A receptor, type II , ACVR2; activin receptor type-2A; ACTRII; ACVR2; |
| GeneID: |
92 |
| mRNA Refseq: |
NM_001616 |
| Protein Refseq: |
NP_001607 |
| MIM: |
102581 |
| UniProt ID: |
P27037 |
Not For Human Consumption!
