Recombinant Human ACVR2A Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
ACVR2A-120THP |
| Common Name: |
ACVR2A |
| Product Name: |
Recombinant Human ACVR2A Protein, GMP Grade |
| Product Overview: |
Recombinant Human ACVR2A Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene. |
| Species: |
Human |
| Molecular Mass: |
77829.47 Da |
| AA Sequence: |
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Applications: |
Sotatercept has been used in trials studying the supportive care and treatment of Anemia, Leukemia, Solid Tumors, Bladder Cancer, and multiple myeloma, among others. |
| Usage: |
Anemia; Chronic Myelomonocytic Leukemia; Chronic Myelomonocytic Leukemia (CMML); Low to Intermediate-1 MDS; Myelodysplastic Syndromes (MDS) |
| Gene Name: |
ACVR2A activin A receptor, type IIA [ Homo sapiens (human) ] |
| Official Symbol: |
ACVR2A |
| Synonyms: |
ACVR2A; activin A receptor, type IIA; activin A receptor, type II , ACVR2; activin receptor type-2A; ACTRII; ACVR2; |
| GeneID: |
92 |
| mRNA Refseq: |
NM_001616 |
| Protein Refseq: |
NP_001607 |
| MIM: |
102581 |
| UniProt ID: |
P27037 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
