Recombinant Human AMBP Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
AMBP-116THP Recombinant Human AMBP Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  AMBP-116THP
Common Name:  AMBP
Product Name:  Recombinant Human AMBP Protein, GMP Grade
Product Overview:  Recombinant Human AMBP Protein without tag was expressed in Yeast and was produced in an animal component free process under cGMP guidelines.
Description:  This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes.
Source:  Yeast
Species:  Human
Bio-activity:  Greater than 3000U/mg as measured by BAEE method.
Molecular Mass:  20 kDa
AA Sequence:  AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELL
Endotoxin:  <1 EU/μg of the peptide by the LAL method
Purity:  > 98 % as determined by: (a) Analysis by RP-HPLC. (b) Anion-exchange FPLC.
Applications:  UTI is effective for acute pancreatitis, chronic recurrent pancreatitis and hemorrhagic, traumatic and endotoxic shocks.
Usage:  Acute pancreatitis, chronic recurrent pancreatitis and hemorrhagic, traumatic and endotoxic shocks.
Storage Buffer:  Sterile Filtered solution. Formulated in 1X PBS.
Gene Name:  AMBP alpha-1-microglobulin/bikunin precursor [ Homo sapiens (human) ]
Official Symbol:  AMBP
Synonyms:  AMBP; alpha-1-microglobulin/bikunin precursor; ITI, ITIL; protein AMBP; bikunin; complex forming glycoprotein heterogeneous in charge; EDC1; growth inhibiting protein 19; HCP; HI30; IATIL; inter alpha trypsin inhibitor light chain; ITILC; protein HC; trypstatin; uristatin; uronic acid rich protein; UTI; uronic-acid-rich protein; growth-inhibiting protein 19; inter-alpha-trypsin inhibitor light chain; complex-forming glycoprotein heterogeneous in charge; A1M; ITI; ITIL;
GeneID:  259
mRNA Refseq:  NM_001633
Protein Refseq:  NP_001624
MIM:  176870
UniProt ID:  P02760
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.