Recombinant Human AMBP Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
AMBP-116THP |
| Common Name: |
AMBP |
| Product Name: |
Recombinant Human AMBP Protein, GMP Grade |
| Product Overview: |
Recombinant Human AMBP Protein without tag was expressed in Yeast and was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. |
| Source: |
Yeast |
| Species: |
Human |
| Bio-activity: |
Greater than 3000U/mg as measured by BAEE method. |
| Molecular Mass: |
20 kDa |
| AA Sequence: |
AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELL |
| Endotoxin: |
<1 EU/μg of the peptide by the LAL method |
| Purity: |
> 98 % as determined by: (a) Analysis by RP-HPLC. (b) Anion-exchange FPLC. |
| Applications: |
UTI is effective for acute pancreatitis, chronic recurrent pancreatitis and hemorrhagic, traumatic and endotoxic shocks. |
| Usage: |
Acute pancreatitis, chronic recurrent pancreatitis and hemorrhagic, traumatic and endotoxic shocks. |
| Storage Buffer: |
Sterile Filtered solution. Formulated in 1X PBS. |
| Gene Name: |
AMBP alpha-1-microglobulin/bikunin precursor [ Homo sapiens (human) ] |
| Official Symbol: |
AMBP |
| Synonyms: |
AMBP; alpha-1-microglobulin/bikunin precursor; ITI, ITIL; protein AMBP; bikunin; complex forming glycoprotein heterogeneous in charge; EDC1; growth inhibiting protein 19; HCP; HI30; IATIL; inter alpha trypsin inhibitor light chain; ITILC; protein HC; trypstatin; uristatin; uronic acid rich protein; UTI; uronic-acid-rich protein; growth-inhibiting protein 19; inter-alpha-trypsin inhibitor light chain; complex-forming glycoprotein heterogeneous in charge; A1M; ITI; ITIL; |
| GeneID: |
259 |
| mRNA Refseq: |
NM_001633 |
| Protein Refseq: |
NP_001624 |
| MIM: |
176870 |
| UniProt ID: |
P02760 |
Not For Human Consumption!
