Recombinant Human ARSB Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
ARSB-115THP |
| Common Name: |
ARSB |
| Product Name: |
Recombinant Human ARSB Protein, GMP Grade |
| Product Overview: |
Recombinant Human ARSB Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Species: |
Human |
| Bio-activity: |
1 mg/mL |
| Molecular Mass: |
56012.6 Da |
| AA Sequence: |
SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of adults and children with Mucopolysaccharidosis VI. |
| Usage: |
Mucopolysaccharidosis VI |
| Gene Name: |
ARSB arylsulfatase B [ Homo sapiens (human) ] |
| Official Symbol: |
ARSB |
| Synonyms: |
ARSB; arylsulfatase B; ASB; G4S; MPS6; arylsulfatase B; N-acetylgalactosamine-4-sulfatase; EC 3.1.6.12 |
| GeneID: |
411 |
| mRNA Refseq: |
NM_000046 |
| Protein Refseq: |
NP_000037 |
| MIM: |
611542 |
| UniProt ID: |
P15848 |
Not For Human Consumption!
