Recombinant Human CSF3 Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
CSF3-110THP |
| Common Name: |
CSF3 |
| Product Name: |
Recombinant Human CSF3 Protein, GMP Grade |
| Product Overview: |
Recombinant Human CSF3 Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. |
| Species: |
Human |
| Bio-activity: |
48000000 U/0.5ml |
| Molecular Mass: |
18800.0 Da |
| AA Sequence: |
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
This drug is a leucocyte growth factor indicated to:Decrease the incidence of infection‚ as manifested by febrile neutropenia‚in patients with nonmyeloid malignancies receiving myelosuppressive anti-cancer drugs associated with a significant incidence of severe neutropenia with fever. Reduce the time to neutrophil recovery and the duration of fever, following induction or consolidation chemotherapy treatment in patients with acute myeloid leukemia (AML)Reduce the duration of neutropenia and neutropenia-related clinical sequelae‚ e.g.‚ febrile neutropenia, in patients with nonmyeloid malignancies undergoing myeloablative chemotherapy followed by bone marrow transplantation (BMT)Mobilize autologous hematopoietic progenitor cells into the peripheral blood for collection by leukapheresisReduce the incidence and duration of sequelae of severe neutropenia (e.g.‚ fever‚ infections‚ oropharyngeal ulcers) in symptomatic patients with congenital neutropenia‚ cyclic neutropenia‚ or idiopathic neutropenia.Neupogen is approved for treatment of patients with radiation-induced myelosuppression following a radiological/nuclear incident. |
| Usage: |
Radiation-induced myelosuppression |
| Gene Name: |
CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens (human) ] |
| Official Symbol: |
CSF3 |
| Synonyms: |
CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
| GeneID: |
1440 |
| mRNA Refseq: |
NM_000759 |
| Protein Refseq: |
NP_000750 |
| MIM: |
138970 |
| UniProt ID: |
P09919 |
Not For Human Consumption!
