Recombinant Human EGF Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
EGF-108THP |
| Common Name: |
EGF |
| Product Name: |
Recombinant Human EGF Protein, GMP Grade |
| Product Overview: |
Recombinant Human EGF Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. |
| Species: |
Human |
| AA Sequence: |
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
Upon topical application, recombinant human epidermal growth factor (rhEGF) may stimulate epithelial proliferation, differentiation and migration, which may result in the acceleration of epithelial regeneration and wound healing. In addition, rhEGF may attenuate epithelial cytotoxicities related to chemotherapy and/or radiotherapy. |
| Usage: |
Oral Mucositis; Colorectal Cancers |
| Gene Name: |
EGF epidermal growth factor [ Homo sapiens (human) ] |
| Official Symbol: |
EGF |
| Synonyms: |
EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
| GeneID: |
1950 |
| mRNA Refseq: |
NM_001178130 |
| Protein Refseq: |
NP_001171601 |
| MIM: |
131530 |
| UniProt ID: |
P01133 |
Not For Human Consumption!
