| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| EPO-107THP | Recombinant Human EPO Protein, GMP Grade | 10ug | $998.00 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | EPO-107THP |
| Common Name: | EPO |
| Product Name: | Recombinant Human EPO Protein, GMP Grade |
| Product Overview: | Recombinant Human EPO Protein without tag was expressed in Mammalian cells and was produced in an animal component free process under cGMP guidelines. |
| Description: | This gene encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The encoded protein is mainly synthesized in the kidney, secreted into the blood plasma, and binds to the erythropoietin receptor to promote red blood cell production, or erythropoiesis, in the bone marrow. Expression of this gene is upregulated under hypoxic conditions, in turn leading to increased erythropoiesis and enhanced oxygen-carrying capacity of the blood. Expression of this gene has also been observed in brain and in the eye, and elevated expression levels have been observed in diabetic retinopathy and ocular hypertension. Recombinant forms of the encoded protein exhibit neuroprotective activity against a variety of potential brain injuries, as well as antiapoptotic functions in several tissue types, and have been used in the treatment of anemia and to enhance the efficacy of cancer therapies. |
| Source: | Mammalian cells |
| Species: | Human |
| Bio-activity: | 8000 IU/0.8ml |
| Molecular Mass: | 18396.1 Da |
| AA Sequence: | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| Endotoxin: | <0.001 EU/μg of the peptide by the LAL method |
| Purity: | > 99 % by SDS-PAGE and HPLC analysis |
| Applications: | Indicated in adult and paediatric patients for the: treatment of anemia due to Chronic Kidney Disease (CKD) in patients on dialysis and not on dialysis.treatment of anemia due to zidovudine in patients with HIV-infection. treatment of anemia due to the effects of concomitant myelosuppressive chemotherapy, and upon initiation, there is a minimum of two additional months of planned chemotherapy.reduction of allogeneic RBC transfusions in patients undergoing elective, noncardiac, nonvascular surgery. |
| Usage: | Anemia |
| Gene Name: | EPO erythropoietin [ Homo sapiens (human) ] |
| Official Symbol: | EPO |
| Synonyms: | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
| GeneID: | 2056 |
| mRNA Refseq: | NM_000799 |
| Protein Refseq: | NP_000790 |
| MIM: | 133170 |
| UniProt ID: | P01588 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
| G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
| G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
| IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
| FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools