Recombinant Human EPO Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
EPO-107THP Recombinant Human EPO Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  EPO-107THP
Common Name:  EPO
Product Name:  Recombinant Human EPO Protein, GMP Grade
Product Overview:  Recombinant Human EPO Protein without tag was expressed in Mammalian cells and was produced in an animal component free process under cGMP guidelines.
Description:  This gene encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The encoded protein is mainly synthesized in the kidney, secreted into the blood plasma, and binds to the erythropoietin receptor to promote red blood cell production, or erythropoiesis, in the bone marrow. Expression of this gene is upregulated under hypoxic conditions, in turn leading to increased erythropoiesis and enhanced oxygen-carrying capacity of the blood. Expression of this gene has also been observed in brain and in the eye, and elevated expression levels have been observed in diabetic retinopathy and ocular hypertension. Recombinant forms of the encoded protein exhibit neuroprotective activity against a variety of potential brain injuries, as well as antiapoptotic functions in several tissue types, and have been used in the treatment of anemia and to enhance the efficacy of cancer therapies.
Source:  Mammalian cells
Species:  Human
Bio-activity:  8000 IU/0.8ml
Molecular Mass:  18396.1 Da
AA Sequence:  APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  Indicated in adult and paediatric patients for the: treatment of anemia due to Chronic Kidney Disease (CKD) in patients on dialysis and not on dialysis.treatment of anemia due to zidovudine in patients with HIV-infection. treatment of anemia due to the effects of concomitant myelosuppressive chemotherapy, and upon initiation, there is a minimum of two additional months of planned chemotherapy.reduction of allogeneic RBC transfusions in patients undergoing elective, noncardiac, nonvascular surgery.
Usage:  Anemia
Gene Name:  EPO erythropoietin [ Homo sapiens (human) ]
Official Symbol:  EPO
Synonyms:  EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142;
GeneID:  2056
mRNA Refseq:  NM_000799
Protein Refseq:  NP_000790
MIM:  133170
UniProt ID:  P01588
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.