Recombinant Human FGF10 Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
FGF10-091THP |
| Common Name: |
FGF10 |
| Product Name: |
Recombinant Human FGF10 Protein, GMP Grade |
| Product Overview: |
Recombinant Human FGF10 Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. |
| Species: |
Human |
| Molecular Mass: |
16.175 kDa |
| AA Sequence: |
SYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
Investigated for use/treatment in bone marrow transplant, ulcers, and inflammatory bowel disease. |
| Gene Name: |
FGF10 fibroblast growth factor 10 [ Homo sapiens (human) ] |
| Official Symbol: |
FGF10 |
| Synonyms: |
FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; |
| GeneID: |
2255 |
| mRNA Refseq: |
NM_004465 |
| Protein Refseq: |
NP_004456 |
| MIM: |
602115 |
| UniProt ID: |
O15520 |
Not For Human Consumption!
