| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| GCG-087THP | Recombinant Human GCG Protein, GMP Grade | 10ug | $998.00 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | GCG-087THP |
| Common Name: | GCG |
| Product Name: | Recombinant Human GCG Protein, GMP Grade |
| Product Overview: | Recombinant Human GCG Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Description: | The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. |
| Source: | E. coli |
| Species: | Human |
| Bio-activity: | 5 mg/0.5ml |
| Molecular Mass: | 3752.0 Da |
| AA Sequence: | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Endotoxin: | <0.001 EU/μg by the LAL method |
| Applications: | Treatment of short bowel syndrome (SBS), malabsorption associated with the removal of the intestine, in adults patients who are dependent on parenteral support. |
| Usage: | Short bowel syndrome (SBS) and malabsorption |
| Gene Name: | GCG glucagon [ Homo sapiens (human) ] |
| Official Symbol: | GCG |
| Synonyms: | GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide; |
| GeneID: | 2641 |
| mRNA Refseq: | NM_002054 |
| Protein Refseq: | NP_002045 |
| MIM: | 138030 |
| UniProt ID: | P01275 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
| G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
| G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
| IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
| FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools