Recombinant Human GCSF Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
GCSF-138THP |
| Common Name: |
GCSF |
| Product Name: |
Recombinant Human GCSF Protein, GMP Grade |
| Product Overview: |
Recombinant Human GCSF Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli |
| Species: |
Human |
| Bio-activity: |
10 mg/mL |
| Molecular Mass: |
18802.8 Da |
| AA Sequence: |
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Applications: |
The product is indicated for use in patients receiving myelosuppressive chemotherapy for non-myeloid malignancies to reduce the incidence of infection. |
| Usage: |
Non-myeloid malignancies |
| Official Symbol: |
GCSF |
| Synonyms: |
GCSF |
Not For Human Consumption!
