Recombinant Human GCSF Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
GCSF-139THP |
| Common Name: |
GCSF |
| Product Name: |
Recombinant Human GCSF Protein, GMP Grade |
| Product Overview: |
Recombinant Human GCSF Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| Bio-activity: |
6 mg/vial |
| Molecular Mass: |
39000.0 Da (glycoPEGylated, approximate) |
| AA Sequence: |
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
Indicated for the reduction in the duration of neutropenia and the incidence of febrile neutropenia in adult patients treated with cytotoxic chemotherapy for malignancy (with the exception of chronic myeloid leukaemia and myelodysplastic syndromes). |
| Usage: |
Reduction in the duration of neutropenia and the incidence of febrile neutropenia |
| Official Symbol: |
GCSF |
| Synonyms: |
GCSF |
Not For Human Consumption!
