| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| GCSF-139THP | Recombinant Human GCSF Protein, GMP Grade | 10ug | $998.00 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | GCSF-139THP |
| Common Name: | GCSF |
| Product Name: | Recombinant Human GCSF Protein, GMP Grade |
| Product Overview: | Recombinant Human GCSF Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: | Human |
| Bio-activity: | 6 mg/vial |
| Molecular Mass: | 39000.0 Da (glycoPEGylated, approximate) |
| AA Sequence: | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Endotoxin: | <0.001 EU/μg by the LAL method |
| Purity: | > 99 % by SDS-PAGE and HPLC analysis |
| Applications: | Indicated for the reduction in the duration of neutropenia and the incidence of febrile neutropenia in adult patients treated with cytotoxic chemotherapy for malignancy (with the exception of chronic myeloid leukaemia and myelodysplastic syndromes). |
| Usage: | Reduction in the duration of neutropenia and the incidence of febrile neutropenia |
| Official Symbol: | GCSF |
| Synonyms: | GCSF |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
| G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
| G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
| IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
| FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools