Cat#: | GLP1-142THP |
Common Name: | GLP1 |
Product Name: | Recombinant Human GLP1 Protein, GMP Grade |
Product Overview: | Recombinant Human GLP1 Protein without tag was produced in an animal component free process under cGMP guidelines. |
Species: | Human |
Bio-activity: | 3 mg/mL |
Molecular Mass: | 59669.81 Da |
AA Sequence: | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG |
Endotoxin: | <0.001 EU/μg of the peptide by the LAL method |
Purity: | > 99 % by SDS-PAGE and HPLC analysis |
Applications: | Indicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus. |
Usage: | Type 2 diabetes mellitus. |
Official Symbol: | GLP1 |
Synonyms: | GLP1 |
Catalog# | Product Name | Inquiry |
---|---|---|
lysosomal beta glucuronidase-1 | Recombinant Human lysosomal beta glucuronidase Protein, GMP Grade | Inquiry |
Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools