Recombinant Human GM-CSF Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
GM-CSF-144THP Recombinant Human GM-CSF Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
Cat#:  GM-CSF-144THP
Common Name:  GM-CSF
Product Name:  Recombinant Human GM-CSF Protein, GMP Grade
Product Overview:  Recombinant Human GM-CSF Protein without tag was expressed in Yeast and was produced in an animal component free process under cGMP guidelines.
Source:  Yeast
Species:  Human
Bio-activity:  500 μg/mL
Molecular Mass:  14434.5 Da
AA Sequence:  APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  For the treatment of cancer and bone marrow transplant.
Usage:  Cancer and bone marrow transplant
Official Symbol:  GM-CSF
Synonyms:  GM-CSF
Catalog# Product Name Inquiry
Grp O-04THP Synthetic HIV-1 group O specific peptide, GMP Grade Inquiry
G5-07THP Synthetic HIV-2 G5 specific peptide, GMP Grade Inquiry
G5-08THP Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade Inquiry
IL21-065THP Recombinant Human IL21 Protein, GMP Grade Inquiry
FGF20-066THP Recombinant Human FGF20 Protein, GMP Grade Inquiry


Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.