Cat# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
GM-CSF-145THP | Recombinant Human GM-CSF Protein, GMP Grade | 10ug | $998.00 |
|
|
Quote Order Bulk Order |
Cat#: | GM-CSF-145THP |
Common Name: | GM-CSF |
Product Name: | Recombinant Human GM-CSF Protein, GMP Grade |
Product Overview: | Recombinant Human GM-CSF Protein without tag was expressed in CHO and was produced in an animal component free process under cGMP guidelines. |
Source: | CHO |
Species: | Human |
Molecular Mass: | 14305.3332 |
AA Sequence: | APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQTITFESFKENLKDFLLVIPFDCWEPVQE |
Endotoxin: | <0.001 EU/μg of the peptide by the LAL method |
Purity: | > 99 % by SDS-PAGE and HPLC analysis |
Applications: | Investigated for use/treatment in adverse effects (chemotherapy) and bone marrow transplant. |
Usage: | Adverse effects (chemotherapy) and bone marrow transplant |
Official Symbol: | GM-CSF |
Synonyms: | GM-CSF |
Catalog# | Product Name | Inquiry |
---|---|---|
Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools