- Home
- Products
- Services
- Applications
- Resource
- Company
| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| Insulin Aspart-152THP | Recombinant Human Insulin Aspart Protein, GMP Grade | 10ug | $998.00 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | Insulin Aspart-152THP |
| Common Name: | Insulin Aspart |
| Product Name: | Recombinant Human Insulin Aspart Protein, GMP Grade |
| Product Overview: | Recombinant human Insulin Aspart Protein without tag was expressed in Saccharomyces cerevisiae and was produced in an animal component free process under cGMP guidelines. |
| Source: | Saccharomyces cerevisiae |
| Species: | Human |
| Bio-activity: | 100 U/ml |
| Molecular Mass: | 5825.8 Da |
| AA Sequence: | >A chain: GIVEQCCTSICSLYQLENYCN >B chain: FVNQHLCGSHLVEALYLVCGERGFFYTDKT |
| Endotoxin: | <0.1 EU/μg of the protein by the LAL method |
| Purity: | > 99 % by SDS-PAGE and HPLC analysis |
| Applications: | For the treatment of Type 1 or 2 diabetes mellitus. Should normally be used in conjunction with an intermediate or long-acting insulin. |
| Usage: | Type 1 or 2 diabetes mellitus |
| Official Symbol: | Insulin Aspart |
| Synonyms: | Insulin Aspart |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
| G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
| G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
| IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
| FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
