Recombinant Human Insulin Aspart Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Insulin Aspart-152THP |
| Common Name: |
Insulin Aspart |
| Product Name: |
Recombinant Human Insulin Aspart Protein, GMP Grade |
| Product Overview: |
Recombinant human Insulin Aspart Protein without tag was expressed in Saccharomyces cerevisiae and was produced in an animal component free process under cGMP guidelines. |
| Source: |
Saccharomyces cerevisiae |
| Species: |
Human |
| Bio-activity: |
100 U/ml |
| Molecular Mass: |
5825.8 Da |
| AA Sequence: |
>A chain: GIVEQCCTSICSLYQLENYCN
>B chain: FVNQHLCGSHLVEALYLVCGERGFFYTDKT |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of Type 1 or 2 diabetes mellitus. Should normally be used in conjunction with an intermediate or long-acting insulin. |
| Usage: |
Type 1 or 2 diabetes mellitus |
| Official Symbol: |
Insulin Aspart |
| Synonyms: |
Insulin Aspart |
Not For Human Consumption!
