Recombinant Human Insulin Glargine Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Insulin Glargine-153THP |
| Common Name: |
Insulin Glargine |
| Product Name: |
Recombinant Human Insulin Glargine Protein, GMP Grade |
| Product Overview: |
Recombinant Human Insulin Glargine Protein without tag was expressed in E. coli (K12) and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli (K12) |
| Species: |
Human |
| Bio-activity: |
100 U/ml |
| Molecular Mass: |
6063.0 Da |
| AA Sequence: |
GIVEQCCTSICSLYQLENYCGFVNQHLCGSHLVEALYLVCGERGFFYTPKTRR |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of Type 1 or 2 diabetes mellitus in patients over 17 years old who require a long-acting (basal) insulin for the control of hyperglycemia. May be used in pediatric patients with Type 1 diabetes mellitus who require a long-acting (basal) insulin for glycemic control. |
| Usage: |
Type 1 or 2 diabetes mellitus |
| Official Symbol: |
Insulin Glargine |
| Synonyms: |
Insulin Glargine |
Not For Human Consumption!
