Recombinant Human Insulin Glulisine Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Insulin Glulisine-154THP |
| Common Name: |
Insulin Glulisine |
| Product Name: |
Recombinant Human Insulin Glulisine Protein, GMP Grade |
| Product Overview: |
Recombinant Human Insulin Glulisine Protein without tag was expressed in E. coli (K12) and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli (K12) |
| Species: |
Human |
| Bio-activity: |
100 IU/ml |
| Molecular Mass: |
5823.0 Da |
| AA Sequence: |
GIVEQCCTSICSLYQLENYCNFVKQHLCGSHLVEALYLVCGERGFFYTPET |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of Type 1 and 2 diabetes mellitus. Should be used in regimens including a long-acting or basal insulin analogue unless it is used in a continuous infusion pump. May be used with oral antidiabetic agents. |
| Usage: |
Type 1 or 2 diabetes mellitus |
| Official Symbol: |
Insulin Glulisine |
| Synonyms: |
Insulin Glulisine |
Not For Human Consumption!
