Recombinant Human Insulin Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Insulin-151THP |
| Common Name: |
Insulin |
| Product Name: |
Recombinant Human Insulin Protein, GMP Grade |
| Product Overview: |
Recombinant Human Insulin Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| Bio-activity: |
100 IU/ml |
| Molecular Mass: |
5808.0 Da |
| AA Sequence: |
GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
Indicated as an adjunct to diet and exercise to improve glycemic control in adults and children with type 1 and type 2 diabetes mellitus. |
| Usage: |
Type 1 or 2 diabetes mellitus |
| Official Symbol: |
Insulin |
| Synonyms: |
Insulin |
Not For Human Consumption!
