Recombinant Human Insulin Protein, GMP Grade


  • Specification
  • Related Products
Cat#:  Insulin-151THP
Common Name:  Insulin
Product Name:  Recombinant Human Insulin Protein, GMP Grade
Product Overview:  Recombinant Human Insulin Protein without tag was produced in an animal component free process under cGMP guidelines.
Species:  Human
Bio-activity:  100 IU/ml
Molecular Mass:  5808.0 Da
AA Sequence:  GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  Indicated as an adjunct to diet and exercise to improve glycemic control in adults and children with type 1 and type 2 diabetes mellitus.
Usage:  Type 1 or 2 diabetes mellitus
Official Symbol:  Insulin
Synonyms:  Insulin
Catalog# Product Name Inquiry
lysosomal beta glucuronidase-1 Recombinant Human lysosomal beta glucuronidase Protein, GMP Grade Inquiry
Grp O-04THP Synthetic HIV-1 group O specific peptide, GMP Grade Inquiry
G5-07THP Synthetic HIV-2 G5 specific peptide, GMP Grade Inquiry
G5-08THP Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade Inquiry
IL21-065THP Recombinant Human IL21 Protein, GMP Grade Inquiry


For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.