Recombinant Human Interferon Alfa 2a Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
Interferon Alfa 2a-156THP Recombinant Human Interferon Alfa 2a Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  Interferon Alfa 2a-156THP
Common Name:  Interferon Alfa 2a
Product Name:  Recombinant Human Interferon Alfa 2a Protein, GMP Grade
Product Overview:  Recombinant Human Interferon Alfa 2a Protein without tag was produced in an animal component free process under cGMP guidelines.
Species:  Human
Bio-activity:  6M U/ml
Molecular Mass:  19241.1 Da
AA Sequence:  CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Endotoxin:  <0.001 EU/μg by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Usage:  Chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia.
Official Symbol:  Interferon Alfa 2a
Synonyms:  Interferon Alfa 2a
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.