Recombinant Human Interferon Alfa 2a Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon Alfa 2a-156THP |
| Common Name: |
Interferon Alfa 2a |
| Product Name: |
Recombinant Human Interferon Alfa 2a Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon Alfa 2a Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| Bio-activity: |
6M U/ml |
| Molecular Mass: |
19241.1 Da |
| AA Sequence: |
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
| Usage: |
Chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. |
| Official Symbol: |
Interferon Alfa 2a |
| Synonyms: |
Interferon Alfa 2a |
Not For Human Consumption!
