Cat#: | Interferon Alfa 2a-156THP |
Common Name: | Interferon Alfa 2a |
Product Name: | Recombinant Human Interferon Alfa 2a Protein, GMP Grade |
Product Overview: | Recombinant Human Interferon Alfa 2a Protein without tag was produced in an animal component free process under cGMP guidelines. |
Species: | Human |
Bio-activity: | 6M U/ml |
Molecular Mass: | 19241.1 Da |
AA Sequence: | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Endotoxin: | <0.001 EU/μg by the LAL method |
Purity: | > 99 % by SDS-PAGE and HPLC analysis |
Applications: | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Usage: | Chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. |
Official Symbol: | Interferon Alfa 2a |
Synonyms: | Interferon Alfa 2a |
Catalog# | Product Name | Inquiry |
---|---|---|
lysosomal beta glucuronidase-1 | Recombinant Human lysosomal beta glucuronidase Protein, GMP Grade | Inquiry |
Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools