Recombinant Human Interferon alfacon-1 Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon alfacon-1-157THP |
| Common Name: |
Interferon alfacon-1 |
| Product Name: |
Recombinant Human Interferon alfacon-1 Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon alfacon-1 Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli |
| Species: |
Human |
| Bio-activity: |
0.03 mg/mL |
| Molecular Mass: |
19343.0 Da |
| AA Sequence: |
MCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWDESLLEKFYTELYQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNLQERLRRKE |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma. |
| Usage: |
Hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma |
| Official Symbol: |
Interferon alfacon-1 |
| Synonyms: |
Interferon alfacon-1 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
