Recombinant Human Interferon alpha 2b Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
Interferon alpha 2b-158THP Recombinant Human Interferon alpha 2b Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  Interferon alpha 2b-158THP
Common Name:  Interferon alpha 2b
Product Name:  Recombinant Human Interferon alpha 2b Protein, GMP Grade
Product Overview:  Recombinant Human Interferon alpha 2b Protein without tag was produced in an animal component free process under cGMP guidelines.
Species:  Human
Bio-activity:  15000000 unit/mL
Molecular Mass:  19271.0 Da
AA Sequence:  CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Endotoxin:  <0.001 EU/μg by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  For the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma.
Usage:  Hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma.
Official Symbol:  Interferon alpha 2b
Synonyms:  Interferon alpha 2b
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.