Recombinant Human Interferon alpha 2b Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon alpha 2b-158THP |
| Common Name: |
Interferon alpha 2b |
| Product Name: |
Recombinant Human Interferon alpha 2b Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon alpha 2b Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| Bio-activity: |
15000000 unit/mL |
| Molecular Mass: |
19271.0 Da |
| AA Sequence: |
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma. |
| Usage: |
Hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma. |
| Official Symbol: |
Interferon alpha 2b |
| Synonyms: |
Interferon alpha 2b |
Not For Human Consumption!
