Recombinant Human Interferon alpha 2b Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon alpha 2b-158THP |
| Common Name: |
Interferon alpha 2b |
| Product Name: |
Recombinant Human Interferon alpha 2b Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon alpha 2b Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| Bio-activity: |
15000000 unit/mL |
| Molecular Mass: |
19271.0 Da |
| AA Sequence: |
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma. |
| Usage: |
Hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma. |
| Official Symbol: |
Interferon alpha 2b |
| Synonyms: |
Interferon alpha 2b |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
