Recombinant Human Interferon beta-1b Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
Interferon beta-1b-159THP Recombinant Human Interferon beta-1b Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  Interferon beta-1b-159THP
Common Name:  Interferon beta-1b
Product Name:  Recombinant Human Interferon beta-1b Protein, GMP Grade
Product Overview:  Recombinant Human Interferon beta-1b Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines.
Source:  E. coli
Species:  Human
Bio-activity:  250 μg/mL
Molecular Mass:  20011.0 Da
AA Sequence:  SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Endotoxin:  <0.001 EU/μg by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  The product is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.
Usage:  Relapsing/remitting multiple sclerosis
Official Symbol:  Interferon beta-1b
Synonyms:  Interferon beta-1b
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.