Recombinant Human Interferon beta-1b Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon beta-1b-159THP |
| Common Name: |
Interferon beta-1b |
| Product Name: |
Recombinant Human Interferon beta-1b Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon beta-1b Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli |
| Species: |
Human |
| Bio-activity: |
250 μg/mL |
| Molecular Mass: |
20011.0 Da |
| AA Sequence: |
SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
The product is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks. |
| Usage: |
Relapsing/remitting multiple sclerosis |
| Official Symbol: |
Interferon beta-1b |
| Synonyms: |
Interferon beta-1b |
Not For Human Consumption!
