Recombinant Human Interferon beta-1b Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon beta-1b-159THP |
| Common Name: |
Interferon beta-1b |
| Product Name: |
Recombinant Human Interferon beta-1b Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon beta-1b Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli |
| Species: |
Human |
| Bio-activity: |
250 μg/mL |
| Molecular Mass: |
20011.0 Da |
| AA Sequence: |
SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
The product is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks. |
| Usage: |
Relapsing/remitting multiple sclerosis |
| Official Symbol: |
Interferon beta-1b |
| Synonyms: |
Interferon beta-1b |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
