Recombinant Human Interferon gamma-1b Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon gamma-1b-160THP |
| Common Name: |
Interferon gamma-1b |
| Product Name: |
Recombinant Human Interferon gamma-1b Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon gamma-1b Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli |
| Species: |
Human |
| Bio-activity: |
100 μg/0.5mL |
| Molecular Mass: |
17145.6 Da |
| AA Sequence: |
CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
Interferon gamma-1b is used for the treatment of Chronic granulomatous disease and Osteopetrosis. |
| Usage: |
Chronic granulomatous disease and Osteopetrosis |
| Official Symbol: |
Interferon gamma-1b |
| Synonyms: |
Interferon gamma-1b |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
