Recombinant Human Interferon gamma-1b Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Interferon gamma-1b-160THP |
| Common Name: |
Interferon gamma-1b |
| Product Name: |
Recombinant Human Interferon gamma-1b Protein, GMP Grade |
| Product Overview: |
Recombinant Human Interferon gamma-1b Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Source: |
E. coli |
| Species: |
Human |
| Bio-activity: |
100 μg/0.5mL |
| Molecular Mass: |
17145.6 Da |
| AA Sequence: |
CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
Interferon gamma-1b is used for the treatment of Chronic granulomatous disease and Osteopetrosis. |
| Usage: |
Chronic granulomatous disease and Osteopetrosis |
| Official Symbol: |
Interferon gamma-1b |
| Synonyms: |
Interferon gamma-1b |
Not For Human Consumption!
