Recombinant Human Interferon gamma-1b Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
Interferon gamma-1b-160THP Recombinant Human Interferon gamma-1b Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  Interferon gamma-1b-160THP
Common Name:  Interferon gamma-1b
Product Name:  Recombinant Human Interferon gamma-1b Protein, GMP Grade
Product Overview:  Recombinant Human Interferon gamma-1b Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines.
Source:  E. coli
Species:  Human
Bio-activity:  100 μg/0.5mL
Molecular Mass:  17145.6 Da
AA Sequence:  CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  Interferon gamma-1b is used for the treatment of Chronic granulomatous disease and Osteopetrosis.
Usage:  Chronic granulomatous disease and Osteopetrosis
Official Symbol:  Interferon gamma-1b
Synonyms:  Interferon gamma-1b
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.