Recombinant Human LEP Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
LEP-081THP |
| Common Name: |
LEP |
| Product Name: |
Recombinant Human LEP Protein, GMP Grade |
| Product Overview: |
Recombinant Human LEP Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development. |
| Source: |
E. coli |
| Species: |
Human |
| Bio-activity: |
11.3 mg/2.2mL |
| Molecular Mass: |
16155.4429 Da |
| AA Sequence: |
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
The product is indicated as an adjunct to diet as replacement therapy to treat the complications of leptin deficiency in patients with congenital or acquired generalized lipodystrophy. |
| Usage: |
Congenital or acquired generalized lipodystrophy |
| Gene Name: |
LEP leptin [ Homo sapiens (human) ] |
| Official Symbol: |
LEP |
| Synonyms: |
LEP; leptin; leptin (murine obesity homolog) , leptin (obesity homolog, mouse) , OB, OBS; obese protein; obesity factor; obese, mouse, homolog of; leptin (murine obesity homolog); leptin (obesity homolog, mouse); OB; OBS; FLJ94114; |
| GeneID: |
3952 |
| mRNA Refseq: |
NM_000230 |
| Protein Refseq: |
NP_000221 |
| UniProt ID: |
P41159 |
Not For Human Consumption!
