Recombinant Human LEP Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
LEP-081THP Recombinant Human LEP Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  LEP-081THP
Common Name:  LEP
Product Name:  Recombinant Human LEP Protein, GMP Grade
Product Overview:  Recombinant Human LEP Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines.
Description:  This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
Source:  E. coli
Species:  Human
Bio-activity:  11.3 mg/2.2mL
Molecular Mass:  16155.4429 Da
AA Sequence:  MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  The product is indicated as an adjunct to diet as replacement therapy to treat the complications of leptin deficiency in patients with congenital or acquired generalized lipodystrophy.
Usage:  Congenital or acquired generalized lipodystrophy
Gene Name:  LEP leptin [ Homo sapiens (human) ]
Official Symbol:  LEP
Synonyms:  LEP; leptin; leptin (murine obesity homolog) , leptin (obesity homolog, mouse) , OB, OBS; obese protein; obesity factor; obese, mouse, homolog of; leptin (murine obesity homolog); leptin (obesity homolog, mouse); OB; OBS; FLJ94114;
GeneID:  3952
mRNA Refseq:  NM_000230
Protein Refseq:  NP_000221
UniProt ID:  P41159
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.