Recombinant Human LH Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
LH-161THP |
| Common Name: |
LH |
| Product Name: |
Recombinant Human LH Protein, GMP Grade |
| Product Overview: |
Recombinant Human LH Protein without tag was expressed in Yeast and was produced in an animal component free process under cGMP guidelines. |
| Source: |
Yeast |
| Species: |
Human |
| Bio-activity: |
450 unit/0.72 mL |
| Molecular Mass: |
30000.0 Da |
| AA Sequence: |
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For treatment of infertility in women with hypothalamic or pituitary insufficiency (hypogonadotropic hypogonadism) and profound LH deficiency (LH <1.2 international units [IU]/L). |
| Usage: |
Infertility in women with hypothalamic or pituitary insufficiency (hypogonadotropic hypogonadism) and profound LH deficiency. |
| Official Symbol: |
LH |
| Synonyms: |
LH |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
