Recombinant Human LH Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
LH-161THP |
| Common Name: |
LH |
| Product Name: |
Recombinant Human LH Protein, GMP Grade |
| Product Overview: |
Recombinant Human LH Protein without tag was expressed in Yeast and was produced in an animal component free process under cGMP guidelines. |
| Source: |
Yeast |
| Species: |
Human |
| Bio-activity: |
450 unit/0.72 mL |
| Molecular Mass: |
30000.0 Da |
| AA Sequence: |
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL |
| Endotoxin: |
<0.001 EU/μg by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For treatment of infertility in women with hypothalamic or pituitary insufficiency (hypogonadotropic hypogonadism) and profound LH deficiency (LH <1.2 international units [IU]/L). |
| Usage: |
Infertility in women with hypothalamic or pituitary insufficiency (hypogonadotropic hypogonadism) and profound LH deficiency. |
| Official Symbol: |
LH |
| Synonyms: |
LH |
Not For Human Consumption!
