Recombinant Human LIPA Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
LIPA-080THP |
| Common Name: |
LIPA |
| Product Name: |
Recombinant Human LIPA Protein, GMP Grade |
| Product Overview: |
Recombinant Human LIPA Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. |
| Species: |
Human |
| Bio-activity: |
2 mg/mL |
| Molecular Mass: |
55000.0 Da |
| AA Sequence: |
SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
The product is a hydrolytic lysosomal cholesteryl ester and triacylglycerol-specific enzyme indicated for the treatment of patients with a diagnosis of Lysosomal Acid Lipase (LAL) deficiency. |
| Usage: |
Lysosomal Acid Lipase (LAL) deficiency |
| Gene Name: |
LIPA lipase A, lysosomal acid, cholesterol esterase [ Homo sapiens (human) ] |
| Official Symbol: |
LIPA |
| Synonyms: |
LIPA; lipase A, lysosomal acid, cholesterol esterase; lysosomal acid lipase/cholesteryl ester hydrolase; CESD; LAL; Wolman disease; sterol esterase; cholesteryl esterase; lysosomal acid lipase; cholesterol ester hydrolase; acid cholesteryl ester hydrolase; |
| GeneID: |
3988 |
| mRNA Refseq: |
NM_000235 |
| Protein Refseq: |
NP_000226 |
| MIM: |
613497 |
| UniProt ID: |
P38571 |
Not For Human Consumption!
