Recombinant Human M-CSF Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
M-CSF-163THP Recombinant Human M-CSF Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  M-CSF-163THP
Common Name:  M-CSF
Product Name:  Recombinant Human M-CSF Protein, GMP Grade
Product Overview:  Recombinant Human M-CSF Protein without tag was produced in an animal component free process under cGMP guidelines.
Species:  Human
Molecular Mass:  49033Da
AA Sequence:  SEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFFDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRP
Endotoxin:  <0.1 EU/μg of the protein by the LAL method
Applications:  Investigated for use/treatment in fungal infections.
Official Symbol:  M-CSF
Synonyms:  M-CSF
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.