| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| PDGFB-079THP | Recombinant Human PDGFB Protein, GMP Grade | 10ug | $998.00 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | PDGFB-079THP |
| Common Name: | PDGFB |
| Product Name: | Recombinant Human PDGFB Protein, GMP Grade |
| Product Overview: | Recombinant Human PDGFB Protein without tag was expressed in Yeast and was produced in an animal component free process under cGMP guidelines. |
| Description: | This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants. |
| Source: | Yeast |
| Species: | Human |
| Bio-activity: | 100 μg/g |
| Molecular Mass: | 12294.4 Da |
| AA Sequence: | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Endotoxin: | <0.001 EU/μg of the peptide by the LAL method |
| Purity: | > 99 % by SDS-PAGE and HPLC analysis |
| Applications: | For topical treatment of skin ulcers (from diabetes). |
| Usage: | skin ulcers (from diabetes) |
| Storage: | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 centigrade for 1 week. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Gene Name: | PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens (human) ] |
| Official Symbol: | PDGFB |
| Synonyms: | PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog) , SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858; |
| GeneID: | 5155 |
| mRNA Refseq: | NM_002608 |
| Protein Refseq: | NP_002599 |
| MIM: | 190040 |
| UniProt ID: | P01127 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
| G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
| G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
| IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
| FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools