Recombinant Human PE1 Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
PE1-166THP |
| Common Name: |
PE1 |
| Product Name: |
Recombinant Human PE1 Protein, GMP Grade |
| Product Overview: |
Recombinant Human PE1 Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| AA Sequence: |
VVGGTEAGRNSWPSQISLQYRSGGSWYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSLHGVTSFVSSRGCNVSRKPTVFTRVSAYISWINNVIASN |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Purity: |
> 95 % by SDS-PAGE and HPLC analysis |
| Applications: |
Prevent hemodialysis vascular access failure |
| Usage: |
Chronic Kidney Disease (CKD); Peripheral Artery Disease (PAD) |
| Official Symbol: |
PE1 |
| Synonyms: |
PE1 |
Not For Human Consumption!
