- Home
- Products
- Services
- Applications
- Resource
- Company
| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| PegIFNλ1a-168THP | Recombinant Human PegIFNλ1a Protein, GMP Grade | 10ug | $998.00 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | PegIFNλ1a-168THP |
| Common Name: | PegIFNλ1a |
| Product Name: | Recombinant Human PegIFNλ1a Protein, GMP Grade |
| Product Overview: | Recombinant Human PegIFNλ1a Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: | Human |
| AA Sequence: | *MKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLSLRTSTHPEST (*M=modifiedresidue) |
| Endotoxin: | <0.1 EU/μg of the protein by the LAL method |
| Applications: | Treatment of chronic hepatitis C infection |
| Usage: | Chronic Hepatitis B Virus Infection / Chronic Hepatitis C Virus (HCV) Infection; Hepatitis B Virus (HBV); Hepatitis C Viral Infection; Hepatitis D, Chronic |
| Official Symbol: | PegIFNλ1a |
| Synonyms: | PegIFNλ1a |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
| G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
| G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
| IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
| FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
