Recombinant Human PegIFNλ1a Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
PegIFNλ1a-168THP |
| Common Name: |
PegIFNλ1a |
| Product Name: |
Recombinant Human PegIFNλ1a Protein, GMP Grade |
| Product Overview: |
Recombinant Human PegIFNλ1a Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| AA Sequence: |
*MKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLSLRTSTHPEST (*M=modifiedresidue) |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Applications: |
Treatment of chronic hepatitis C infection |
| Usage: |
Chronic Hepatitis B Virus Infection / Chronic Hepatitis C Virus (HCV) Infection; Hepatitis B Virus (HBV); Hepatitis C Viral Infection; Hepatitis D, Chronic |
| Official Symbol: |
PegIFNλ1a |
| Synonyms: |
PegIFNλ1a |
Not For Human Consumption!
