Recombinant Human PLG Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
PLG-076THP |
| Common Name: |
PLG |
| Product Name: |
Recombinant Human PLG Protein, GMP Grade |
| Product Overview: |
Recombinant Human PLG Protein without tag was expressed in Pichia pastoris and was produced in an animal component free process under cGMP guidelines. |
| Description: |
The plasminogen protein encoded by this gene is a serine protease that circulates in blood plasma as an inactive zymogen and is converted to the active protease, plasmin, by several plasminogen activators such as tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), kallikrein, and factor XII (Hageman factor). The conversion of plasminogen to plasmin involves the cleavage of the peptide bond between Arg-561 and Val-562. Plasmin cleavage also releases the angiostatin protein which inhibits angiogenesis. Plasmin degrades many blood plasma proteins, including fibrin-containing blood clots. As a serine protease, plasmin cleaves many products in addition to fibrin such as fibronectin, thrombospondin, laminin, and von Willebrand factor. Plasmin is inactivated by proteins such as alpha-2-macroglobulin and alpha-2-antiplasmin in addition to inhibitors of the various plasminogen activators. Plasminogen also interacts with plasminogen receptors which results in the retention of plasmin on cell surfaces and in plasmin-induced cell signaling. The localization of plasminogen on cell surfaces plays a role in the degradation of extracellular matrices, cell migration, inflamation, wound healing, oncogenesis, metastasis, myogenesis, muscle regeneration, neurite outgrowth, and fibrinolysis. This protein may also play a role in acute respiratory distress syndrome (ARDS) which, in part, is caused by enhanced clot formation and the suppression of fibrinolysis. Compared to other mammals, the cluster of plasminogen-like genes to which this gene belongs has been rearranged in catarrhine primates. |
| Source: |
Pichia pastoris |
| Species: |
Human |
| Bio-activity: |
2.5 mg/mL |
| Molecular Mass: |
27250.0 Da |
| AA Sequence: |
APSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
The product is a proteolytic enzyme indicated for the treatment for symptomatic vitreomacular adhesion. |
| Usage: |
Symptomatic vitreomacular adhesion |
| Gene Name: |
PLG plasminogen [ Homo sapiens (human) ] |
| Official Symbol: |
PLG |
| Synonyms: |
PLG; plasminogen; plasmin; DKFZp779M0222; |
| GeneID: |
5340 |
| mRNA Refseq: |
NM_001168338 |
| Protein Refseq: |
NP_001161810 |
| MIM: |
173350 |
| UniProt ID: |
P00747 |
Not For Human Consumption!
