Recombinant Human PTH Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
PTH-074THP Recombinant Human PTH Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  PTH-074THP
Common Name:  PTH
Product Name:  Recombinant Human PTH Protein, GMP Grade
Product Overview:  Recombinant Human PTH Protein without tag was produced in an animal component free process under cGMP guidelines.
Description:  This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants.
Species:  Human
Bio-activity:  250 μg/mL
Molecular Mass:  4117.715 Da
AA Sequence:  SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  For the treatment of osteoporosis in men and postmenopausal women who are at high risk for having a fracture. Also used to increase bone mass in men with primary or hypogonadal osteoporosis who are at high risk for fracture.
Usage:  Osteoporosis
Gene Name:  PTH parathyroid hormone [ Homo sapiens (human) ]
Official Symbol:  PTH
Synonyms:  PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1;
GeneID:  5741
mRNA Refseq:  NM_000315
Protein Refseq:  NP_000306
MIM:  168450
UniProt ID:  P01270
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.