Recombinant Human PTH Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
PTH-074THP |
| Common Name: |
PTH |
| Product Name: |
Recombinant Human PTH Protein, GMP Grade |
| Product Overview: |
Recombinant Human PTH Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants. |
| Species: |
Human |
| Bio-activity: |
250 μg/mL |
| Molecular Mass: |
4117.715 Da |
| AA Sequence: |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For the treatment of osteoporosis in men and postmenopausal women who are at high risk for having a fracture. Also used to increase bone mass in men with primary or hypogonadal osteoporosis who are at high risk for fracture. |
| Usage: |
Osteoporosis |
| Gene Name: |
PTH parathyroid hormone [ Homo sapiens (human) ] |
| Official Symbol: |
PTH |
| Synonyms: |
PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1; |
| GeneID: |
5741 |
| mRNA Refseq: |
NM_000315 |
| Protein Refseq: |
NP_000306 |
| MIM: |
168450 |
| UniProt ID: |
P01270 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
