Recombinant Human Ribonuclease enzyme Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
Ribonuclease enzyme-173THP |
| Common Name: |
Ribonuclease enzyme |
| Product Name: |
Recombinant Human Ribonuclease enzyme Protein, GMP Grade |
| Product Overview: |
Recombinant Human Ribonuclease enzyme Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| Molecular Mass: |
11.98 kDa |
| AA Sequence: |
MQDWLTFQKKHITNTRDVDCDNILSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Applications: |
For the treatment of various forms of cancer. |
| Usage: |
Various forms of cancer |
| Storage Buffer: |
PBS, 1 mg/mL |
| Official Symbol: |
Ribonuclease enzyme |
| Synonyms: |
Ribonuclease enzyme |
Not For Human Consumption!
