Recombinant Human Ribonuclease enzyme Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
Ribonuclease enzyme-173THP Recombinant Human Ribonuclease enzyme Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
Cat#:  Ribonuclease enzyme-173THP
Common Name:  Ribonuclease enzyme
Product Name:  Recombinant Human Ribonuclease enzyme Protein, GMP Grade
Product Overview:  Recombinant Human Ribonuclease enzyme Protein without tag was produced in an animal component free process under cGMP guidelines.
Species:  Human
Molecular Mass:  11.98 kDa
AA Sequence:  MQDWLTFQKKHITNTRDVDCDNILSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Applications:  For the treatment of various forms of cancer.
Usage:  Various forms of cancer
Storage Buffer:  PBS, 1 mg/mL
Official Symbol:  Ribonuclease enzyme
Synonyms:  Ribonuclease enzyme
Catalog# Product Name Inquiry
Grp O-04THP Synthetic HIV-1 group O specific peptide, GMP Grade Inquiry
G5-07THP Synthetic HIV-2 G5 specific peptide, GMP Grade Inquiry
G5-08THP Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade Inquiry
IL21-065THP Recombinant Human IL21 Protein, GMP Grade Inquiry
FGF20-066THP Recombinant Human FGF20 Protein, GMP Grade Inquiry


Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.