| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| TNFRSF13B-067THP | Recombinant Human TNFRSF13B Protein, GMP Grade | 10ug | $998.00 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | TNFRSF13B-067THP |
| Common Name: | TNFRSF13B |
| Product Name: | Recombinant Human TNFRSF13B Protein, GMP Grade |
| Product Overview: | Recombinant Human TNFRSF13B Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: | The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Species: | Human |
| Molecular Mass: | 70707.2547 Da |
| AA Sequence: | AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin: | <0.1 EU/μg of the protein by the LAL method |
| Purity: | > 95 % by SDS-PAGE and HPLC analysis |
| Applications: | Investigated for use/treatment in autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid). |
| Usage: | Autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid) |
| Storage: | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 centigrade for 1 week. Aliquots of reconstituted proteins are stable at < -20 centigrade for 3 months. |
| Gene Name: | TNFRSF13B tumor necrosis factor receptor superfamily, member 13B [ Homo sapiens (human) ] |
| Official Symbol: | TNFRSF13B |
| Synonyms: | TNFRSF13B; tumor necrosis factor receptor superfamily, member 13B; tumor necrosis factor receptor superfamily member 13B; CD267; TACI; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor; CVID; CVID2; TNFRSF14B; FLJ39942; MGC39952; MGC133214; |
| GeneID: | 23495 |
| mRNA Refseq: | NM_012452 |
| Protein Refseq: | NP_036584 |
| MIM: | 604907 |
| UniProt ID: | O14836 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| Grp O-04THP | Synthetic HIV-1 group O specific peptide, GMP Grade | Inquiry |
| G5-07THP | Synthetic HIV-2 G5 specific peptide, GMP Grade | Inquiry |
| G5-08THP | Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade | Inquiry |
| IL21-065THP | Recombinant Human IL21 Protein, GMP Grade | Inquiry |
| FGF20-066THP | Recombinant Human FGF20 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools