Recombinant Human TNFRSF13B Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
TNFRSF13B-067THP |
| Common Name: |
TNFRSF13B |
| Product Name: |
Recombinant Human TNFRSF13B Protein, GMP Grade |
| Product Overview: |
Recombinant Human TNFRSF13B Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Species: |
Human |
| Molecular Mass: |
70707.2547 Da |
| AA Sequence: |
AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Purity: |
> 95 % by SDS-PAGE and HPLC analysis |
| Applications: |
Investigated for use/treatment in autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid). |
| Usage: |
Autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid) |
| Storage: |
Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 centigrade for 1 week. Aliquots of reconstituted proteins are stable at < -20 centigrade for 3 months. |
| Gene Name: |
TNFRSF13B tumor necrosis factor receptor superfamily, member 13B [ Homo sapiens (human) ] |
| Official Symbol: |
TNFRSF13B |
| Synonyms: |
TNFRSF13B; tumor necrosis factor receptor superfamily, member 13B; tumor necrosis factor receptor superfamily member 13B; CD267; TACI; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor; CVID; CVID2; TNFRSF14B; FLJ39942; MGC39952; MGC133214; |
| GeneID: |
23495 |
| mRNA Refseq: |
NM_012452 |
| Protein Refseq: |
NP_036584 |
| MIM: |
604907 |
| UniProt ID: |
O14836 |
Not For Human Consumption!
