Recombinant Human TNFRSF13B Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
TNFRSF13B-067THP |
| Common Name: |
TNFRSF13B |
| Product Name: |
Recombinant Human TNFRSF13B Protein, GMP Grade |
| Product Overview: |
Recombinant Human TNFRSF13B Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Description: |
The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Species: |
Human |
| Molecular Mass: |
70707.2547 Da |
| AA Sequence: |
AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin: |
<0.1 EU/μg of the protein by the LAL method |
| Purity: |
> 95 % by SDS-PAGE and HPLC analysis |
| Applications: |
Investigated for use/treatment in autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid). |
| Usage: |
Autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid) |
| Storage: |
Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 centigrade for 1 week. Aliquots of reconstituted proteins are stable at < -20 centigrade for 3 months. |
| Gene Name: |
TNFRSF13B tumor necrosis factor receptor superfamily, member 13B [ Homo sapiens (human) ] |
| Official Symbol: |
TNFRSF13B |
| Synonyms: |
TNFRSF13B; tumor necrosis factor receptor superfamily, member 13B; tumor necrosis factor receptor superfamily member 13B; CD267; TACI; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor; CVID; CVID2; TNFRSF14B; FLJ39942; MGC39952; MGC133214; |
| GeneID: |
23495 |
| mRNA Refseq: |
NM_012452 |
| Protein Refseq: |
NP_036584 |
| MIM: |
604907 |
| UniProt ID: |
O14836 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
