Recombinant Pseudomonas sp. CPG2 Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
CPG2-126THP Recombinant Pseudomonas sp. CPG2 Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
Cat#:  CPG2-126THP
Common Name:  CPG2
Product Name:  Recombinant Pseudomonas sp. CPG2 Protein, GMP Grade
Product Overview:  Recombinant Pseudomonas sp. CPG2 Protein without tag was expressed in E. coli and was produced in an animal component free process under cGMP guidelines.
Source:  E. coli
Species:  Pseudomonas sp.
Bio-activity:  1000U
Molecular Mass:  44016.6653 Da
AA Sequence:  ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  Used in patients on methotrexate treatment who have kidney dysfunction, and are experiencing an abnormally high plasma concentration of methotrexate (> 1 micromole per liter).
Usage:  Kidney dysfunction
Official Symbol:  CPG2
Synonyms:  CPG2
Catalog# Product Name Inquiry
Grp O-04THP Synthetic HIV-1 group O specific peptide, GMP Grade Inquiry
G5-07THP Synthetic HIV-2 G5 specific peptide, GMP Grade Inquiry
G5-08THP Synthetict HIV-2 G5 specific peptide, BSA-conjugated, GMP Grade Inquiry
IL21-065THP Recombinant Human IL21 Protein, GMP Grade Inquiry
FGF20-066THP Recombinant Human FGF20 Protein, GMP Grade Inquiry


Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.