Synthetic Human GLP1 Protein, GMP Grade


Cat# Product Name Availability Size Price Qty
GLP1-140THP Synthetic Human GLP1 Protein, GMP Grade 10ug $998.00
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  GLP1-140THP
Common Name:  GLP1
Product Name:  Synthetic Human GLP1 Protein, GMP Grade
Product Overview:  Synthetic Human GLP1 Protein without tag was produced in an animal component free process under cGMP guidelines.
Species:  Human
Bio-activity:  6 mg/mL
Molecular Mass:  3751.2 Da
AA Sequence:  HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG
Endotoxin:  <0.001 EU/μg of the peptide by the LAL method
Purity:  > 99 % by SDS-PAGE and HPLC analysis
Applications:  For use in/treatment of diabetes mellitus type 2.
Usage:  Diabetes mellitus type 2
Official Symbol:  GLP1
Synonyms:  GLP1
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.