Synthetic Human GLP1 Protein, GMP Grade
- Specification
- Related Products
| Cat#: |
GLP1-140THP |
| Common Name: |
GLP1 |
| Product Name: |
Synthetic Human GLP1 Protein, GMP Grade |
| Product Overview: |
Synthetic Human GLP1 Protein without tag was produced in an animal component free process under cGMP guidelines. |
| Species: |
Human |
| Bio-activity: |
6 mg/mL |
| Molecular Mass: |
3751.2 Da |
| AA Sequence: |
HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG |
| Endotoxin: |
<0.001 EU/μg of the peptide by the LAL method |
| Purity: |
> 99 % by SDS-PAGE and HPLC analysis |
| Applications: |
For use in/treatment of diabetes mellitus type 2. |
| Usage: |
Diabetes mellitus type 2 |
| Official Symbol: |
GLP1 |
| Synonyms: |
GLP1 |
Not For Human Consumption!
