Recombinant Human CSF3 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
CSF3-4340THP Recombinant Human CSF3 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  CSF3-4340THP
Common Name:  CSF3
Product Name:  Recombinant Human CSF3 protein, GMP Grade
Product Overview:  Recombinant Human CSF3 protein GMP Grade(NP_000750) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized from a 0.2 μm filtered concentrated solution in 10 mM sodium acetate buffer, containing 5% trehalose, pH 4.0.
Bio-activity:  The ED50 determined by a cell proliferation assay using murine NFS-60 cells is less than 0.1 ng/mL, corresponding to a specific activity of >1.0 × 10^7 IU/mg.
Molecular Mass:  Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
AA Sequence:  TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Endotoxin:  Less than 1 EU/μg determined by LAL method.
Purity:  Greater than 98% by SDS-PAGE and HPLC analyses.
Storage:  This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
Official Symbol:  CSF3
Synonyms:  CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33;
GeneID:  1440
mRNA Refseq:  NM_000759
Protein Refseq:  NP_000750
MIM:  138970
UniProt ID:  P09919
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.