Recombinant Human CSF3 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
CSF3-4340THP |
| Common Name: |
CSF3 |
| Product Name: |
Recombinant Human CSF3 protein, GMP Grade |
| Product Overview: |
Recombinant Human CSF3 protein GMP Grade(NP_000750) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 μm filtered concentrated solution in 10 mM sodium acetate buffer, containing 5% trehalose, pH 4.0. |
| Bio-activity: |
The ED50 determined by a cell proliferation assay using murine NFS-60 cells is less than 0.1 ng/mL, corresponding to a specific activity of >1.0 × 10^7 IU/mg. |
| Molecular Mass: |
Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids. |
| AA Sequence: |
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Endotoxin: |
Less than 1 EU/μg determined by LAL method. |
| Purity: |
Greater than 98% by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ] |
| Official Symbol: |
CSF3 |
| Synonyms: |
CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
| GeneID: |
1440 |
| mRNA Refseq: |
NM_000759 |
| Protein Refseq: |
NP_000750 |
| MIM: |
138970 |
| UniProt ID: |
P09919 |
Not For Human Consumption!
