Recombinant Human CTLA4 protein, Fc-tag, GMP Grade

Cat#	Product Name	Availability	Size	Price	Qty
CTLA4-155THP	Recombinant Human CTLA4 protein, Fc-tag, GMP Grade		10ug	$998
Quote Order Bulk Order

Cat#:	CTLA4-155THP
Common Name:	CTLA4
Product Name:	Recombinant Human CTLA4 protein, Fc-tag, GMP Grade
Product Overview:	Recombinant Human CTLA4 protein GMP Grade(NP_001032720), fused to Fc tag, was expressed in HEK293 Cells.
Source:	HEK293 Cells
Species:	Human
Tag :	Fc
Form:	Lyophilized.
AA Sequence:	KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPK SSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin:	Less than 0.1EU/ug
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Storage:	Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution:	Recommemnd working concentration: 10-100ug/ml
Gene Name:	CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ]
Official Symbol:	CTLA4
Synonyms:	CTLA4; cytotoxic T-lymphocyte-associated protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3
GeneID:	1493
mRNA Refseq:	NM_001037631
Protein Refseq:	NP_001032720
UniProt ID:	P16410

Catalog#	Product Name	Inquiry
EPO-01THP	Recombinant Human Erythropoietin, GMP Grade	Inquiry
BMP2-01THP	Recombinant Human BMP2 protein, GMP Grade	Inquiry
p65-01THP	Recombinant HIV-1 p65 Protein, GMP Grade	Inquiry
gp160-02THP	Recombinant HIV-1 gp160 Protein, GMP Grade	Inquiry
gp41-03THP	Recombinant HIV-1 gp41 Protein, GMP Grade	Inquiry

Customer Reviews (0)

No reviews available yet.

Q&As (0)

No Q&A available yet.

My Review for