Recombinant Human CTLA4 protein, Fc-tag, GMP Grade


Cat# Product Name Availability Size Price Qty
CTLA4-155THP Recombinant Human CTLA4 protein, Fc-tag, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
Cat#:  CTLA4-155THP
Common Name:  CTLA4
Product Name:  Recombinant Human CTLA4 protein, Fc-tag, GMP Grade
Product Overview:  Recombinant Human CTLA4 protein GMP Grade(NP_001032720), fused to Fc tag, was expressed in HEK293 Cells.
Source:  HEK293 Cells
Species:  Human
Tag :  Fc
Form:  Lyophilized.
AA Sequence:  KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPK SSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin:  Less than 0.1EU/ug
Purity:  Greater than 95% as determined by reducing SDS-PAGE.
Storage:  Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution:  Recommemnd working concentration: 10-100ug/ml
Gene Name:  CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ]
Official Symbol:  CTLA4
Synonyms:  CTLA4; cytotoxic T-lymphocyte-associated protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3
GeneID:  1493
mRNA Refseq:  NM_001037631
Protein Refseq:  NP_001032720
UniProt ID:  P16410
Catalog# Product Name Inquiry
EPO-01THP Recombinant Human Erythropoietin, GMP Grade Inquiry
BMP2-01THP Recombinant Human BMP2 protein, GMP Grade Inquiry
p65-01THP Recombinant HIV-1 p65 Protein, GMP Grade Inquiry
gp160-02THP Recombinant HIV-1 gp160 Protein, GMP Grade Inquiry
gp41-03THP Recombinant HIV-1 gp41 Protein, GMP Grade Inquiry


Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.