Cat# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
CTLA4-155THP | Recombinant Human CTLA4 protein, Fc-tag, GMP Grade | 10ug | $998 |
|
|
Quote Order Bulk Order |
Cat#: | CTLA4-155THP |
Common Name: | CTLA4 |
Product Name: | Recombinant Human CTLA4 protein, Fc-tag, GMP Grade |
Product Overview: | Recombinant Human CTLA4 protein GMP Grade(NP_001032720), fused to Fc tag, was expressed in HEK293 Cells. |
Source: | HEK293 Cells |
Species: | Human |
Tag : | Fc |
Form: | Lyophilized. |
AA Sequence: | KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPK SSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin: | Less than 0.1EU/ug |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Storage: | Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Reconstitution: | Recommemnd working concentration: 10-100ug/ml |
Gene Name: | CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ] |
Official Symbol: | CTLA4 |
Synonyms: | CTLA4; cytotoxic T-lymphocyte-associated protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3 |
GeneID: | 1493 |
mRNA Refseq: | NM_001037631 |
Protein Refseq: | NP_001032720 |
UniProt ID: | P16410 |
Catalog# | Product Name | Inquiry |
---|---|---|
EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools