| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| FGF1-4344THP | Recombinant Human FGF1 protein, GMP Grade | 10ug | $998 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | FGF1-4344THP |
| Common Name: | FGF1 |
| Product Name: | Recombinant Human FGF1 protein, GMP Grade |
| Product Overview: | Recombinant Human FGF1 protein GMP Grade(NP_000791) was expressed in E. coli. |
| Source: | E. coli |
| Species: | Human |
| Form: | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: | The ED50 determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.3 ng/mL, corresponding to a specific activity of >3.3 × 10^6 IU/mg in the presence of 10 μg/mL of heparin. |
| Molecular Mass: | Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 141 amino acids. |
| AA Sequence: | MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Endotoxin: | Less than 1 EU/μg determined by LAL method. |
| Purity: | Greater than 95% by SDS-PAGE and HPLC analyses. |
| Storage: | This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
| Official Symbol: | FGF1 |
| Synonyms: | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
| GeneID: | 2246 |
| mRNA Refseq: | NM_000800 |
| Protein Refseq: | NP_000791 |
| MIM: | 131220 |
| UniProt ID: | P05230 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools