Recombinant Human FGF1 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
FGF1-4344THP Recombinant Human FGF1 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  FGF1-4344THP
Common Name:  FGF1
Product Name:  Recombinant Human FGF1 protein, GMP Grade
Product Overview:  Recombinant Human FGF1 protein GMP Grade(NP_000791) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity:  The ED50 determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.3 ng/mL, corresponding to a specific activity of >3.3 × 10^6 IU/mg in the presence of 10 μg/mL of heparin.
Molecular Mass:  Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
AA Sequence:  MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin:  Less than 1 EU/μg determined by LAL method.
Purity:  Greater than 95% by SDS-PAGE and HPLC analyses.
Storage:  This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ]
Official Symbol:  FGF1
Synonyms:  FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha;
GeneID:  2246
mRNA Refseq:  NM_000800
Protein Refseq:  NP_000791
MIM:  131220
UniProt ID:  P05230
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.