Recombinant Human FGF1 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
FGF1-4344THP |
| Common Name: |
FGF1 |
| Product Name: |
Recombinant Human FGF1 protein, GMP Grade |
| Product Overview: |
Recombinant Human FGF1 protein GMP Grade(NP_000791) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: |
The ED50 determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.3 ng/mL, corresponding to a specific activity of >3.3 × 10^6 IU/mg in the presence of 10 μg/mL of heparin. |
| Molecular Mass: |
Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 141 amino acids. |
| AA Sequence: |
MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Endotoxin: |
Less than 1 EU/μg determined by LAL method. |
| Purity: |
Greater than 95% by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
| Official Symbol: |
FGF1 |
| Synonyms: |
FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
| GeneID: |
2246 |
| mRNA Refseq: |
NM_000800 |
| Protein Refseq: |
NP_000791 |
| MIM: |
131220 |
| UniProt ID: |
P05230 |
Not For Human Consumption!
