Recombinant Human FN1 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
FN1-154THP Recombinant Human FN1 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  FN1-154THP
Common Name:  FN1
Product Name:  Recombinant Human FN1 protein, GMP Grade
Product Overview:  Recombinant Human FN1 protein GMP Grade(NP_002017) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized.
Bio-activity:  Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells.
When 1×10E5 cells/well areadded to Fibronectin-coated plates (7-13 ng/mL and 100μL/well), approximately 50%-80% will adhere specifically after 30 minutes at 37°C.
AA Sequence:  MPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTE YVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFS GRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTS LLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP ASSKPISINYRTEIDKPSMAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMK EINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTIT ISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVV IDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT GLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST
Endotoxin:  Less than 0.1EU/ug
Purity:  Greater than 95% as determined by reducing SDS-PAGE.
Storage:  Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  FN1 fibronectin 1 [ Homo sapiens ]
Official Symbol:  FN1
Synonyms:  FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND
GeneID:  2335
mRNA Refseq:  NM_002026
Protein Refseq:  NP_002017
MIM:  135600
UniProt ID:  P02751
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.