Recombinant Human FN1 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
FN1-154THP |
| Common Name: |
FN1 |
| Product Name: |
Recombinant Human FN1 protein, GMP Grade |
| Product Overview: |
Recombinant Human FN1 protein GMP Grade(NP_002017) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized. |
| Bio-activity: |
Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells.
When 1×10E5 cells/well areadded to Fibronectin-coated plates (7-13 ng/mL and 100μL/well), approximately 50%-80% will adhere specifically after 30 minutes at 37°C. |
| AA Sequence: |
MPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTE YVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFS GRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTS LLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP ASSKPISINYRTEIDKPSMAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMK EINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTIT ISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVV IDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT GLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST |
| Endotoxin: |
Less than 0.1EU/ug |
| Purity: |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: |
Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
FN1 fibronectin 1 [ Homo sapiens ] |
| Official Symbol: |
FN1 |
| Synonyms: |
FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND |
| GeneID: |
2335 |
| mRNA Refseq: |
NM_002026 |
| Protein Refseq: |
NP_002017 |
| MIM: |
135600 |
| UniProt ID: |
P02751 |
Not For Human Consumption!
