Cat# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
FN1-154THP | Recombinant Human FN1 protein, GMP Grade | 10ug | $998 |
|
|
Quote Order Bulk Order |
Cat#: | FN1-154THP |
Common Name: | FN1 |
Product Name: | Recombinant Human FN1 protein, GMP Grade |
Product Overview: | Recombinant Human FN1 protein GMP Grade(NP_002017) was expressed in E. coli. |
Source: | E. coli |
Species: | Human |
Form: | Lyophilized. |
Bio-activity: | Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. When 1×10E5 cells/well areadded to Fibronectin-coated plates (7-13 ng/mL and 100μL/well), approximately 50%-80% will adhere specifically after 30 minutes at 37°C. |
AA Sequence: | MPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTE YVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFS GRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTS LLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP ASSKPISINYRTEIDKPSMAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMK EINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTIT ISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVV IDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT GLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST |
Endotoxin: | Less than 0.1EU/ug |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Storage: | Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name: | FN1 fibronectin 1 [ Homo sapiens ] |
Official Symbol: | FN1 |
Synonyms: | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND |
GeneID: | 2335 |
mRNA Refseq: | NM_002026 |
Protein Refseq: | NP_002017 |
MIM: | 135600 |
UniProt ID: | P02751 |
Catalog# | Product Name | Inquiry |
---|---|---|
EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools