Recombinant Human IFNG protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IFNG-157THP |
| Common Name: |
IFNG |
| Product Name: |
Recombinant Human IFNG protein, GMP Grade |
| Product Overview: |
Recombinant Human IFNG protein GMP Grade(NP_000610) was expressed in HEK293 Cells. |
| Source: |
HEK293 Cells |
| Species: |
Human |
| Form: |
Lyophilized. |
| Bio-activity: |
Measured by a viral resistance assay using VSV-WISH cells.
Specific Activity is greater than 1.5 x 10^7 IU/mg. |
| AA Sequence: |
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQS IQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRK RSQMLFRGRRASQ |
| Endotoxin: |
Less than 0.1EU/ug |
| Purity: |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: |
Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: |
Recommemnd working concentration: 50ng/ml or 1000U/ml |
| Gene Name: |
IFNG interferon, gamma [ Homo sapiens ] |
| Official Symbol: |
IFNG |
| Synonyms: |
IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI |
| GeneID: |
3458 |
| mRNA Refseq: |
NM_000619 |
| Protein Refseq: |
NP_000610 |
| MIM: |
147570 |
| UniProt ID: |
P01579 |
Not For Human Consumption!
