- Home
- Products
- Services
- Applications
- Resource
- Company
| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| IFNG-157THP | Recombinant Human IFNG protein, GMP Grade | 10ug | $998 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | IFNG-157THP |
| Common Name: | IFNG |
| Product Name: | Recombinant Human IFNG protein, GMP Grade |
| Product Overview: | Recombinant Human IFNG protein GMP Grade(NP_000610) was expressed in HEK293 Cells. |
| Source: | HEK293 Cells |
| Species: | Human |
| Form: | Lyophilized. |
| Bio-activity: | Measured by a viral resistance assay using VSV-WISH cells. Specific Activity is greater than 1.5 x 10^7 IU/mg. |
| AA Sequence: | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQS IQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRK RSQMLFRGRRASQ |
| Endotoxin: | Less than 0.1EU/ug |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: | Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: | Recommemnd working concentration: 50ng/ml or 1000U/ml |
| Gene Name: | IFNG interferon, gamma [ Homo sapiens ] |
| Official Symbol: | IFNG |
| Synonyms: | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI |
| GeneID: | 3458 |
| mRNA Refseq: | NM_000619 |
| Protein Refseq: | NP_000610 |
| MIM: | 147570 |
| UniProt ID: | P01579 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
