Recombinant Human IFNG protein, GMP Grade


Cat# Product Name Availability Size Price Qty
IFNG-157THP Recombinant Human IFNG protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  IFNG-157THP
Common Name:  IFNG
Product Name:  Recombinant Human IFNG protein, GMP Grade
Product Overview:  Recombinant Human IFNG protein GMP Grade(NP_000610) was expressed in HEK293 Cells.
Source:  HEK293 Cells
Species:  Human
Form:  Lyophilized.
Bio-activity:  Measured by a viral resistance assay using VSV-WISH cells.
Specific Activity is greater than 1.5 x 10^7 IU/mg.
AA Sequence:  QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQS IQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRK RSQMLFRGRRASQ
Endotoxin:  Less than 0.1EU/ug
Purity:  Greater than 95% as determined by reducing SDS-PAGE.
Storage:  Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution:  Recommemnd working concentration: 50ng/ml or 1000U/ml
Gene Name:  IFNG interferon, gamma [ Homo sapiens ]
Official Symbol:  IFNG
Synonyms:  IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI
GeneID:  3458
mRNA Refseq:  NM_000619
Protein Refseq:  NP_000610
MIM:  147570
UniProt ID:  P01579
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.