| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| IL10-4325THP | Recombinant Human IL10 protein, GMP Grade | 10ug | $998 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | IL10-4325THP |
| Common Name: | IL10 |
| Product Name: | Recombinant Human IL10 protein, GMP Grade |
| Product Overview: | Recombinant Human IL10 protein GMP Grade(NP_000563) was expressed in E. coli. |
| Source: | E. coli |
| Species: | Human |
| Form: | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg. |
| Molecular Mass: | Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. |
| AA Sequence: | SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
| Endotoxin: | Less than 1 EU/µg determined by LAL method. |
| Purity: | Greater than 95 % by SDS-PAGE and HPLC analyses. |
| Storage: | This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: | IL10 interleukin 10 [ Homo sapiens ] |
| Official Symbol: | IL10 |
| Synonyms: | IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF; T-cell growth inhibitory factor; GVHDS; IL-10; MGC126450; MGC126451; |
| GeneID: | 3586 |
| mRNA Refseq: | NM_000572 |
| Protein Refseq: | NP_000563 |
| MIM: | 124092 |
| UniProt ID: | P22301 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools