Recombinant Human IL12 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL12-158THP |
| Common Name: |
IL12 |
| Product Name: |
Recombinant Human IL12 protein, GMP Grade |
| Product Overview: |
Recombinant Human IL12 protein GMP Grade(NP_000873) was expressed in HEK293 Cells. |
| Source: |
HEK293 Cells |
| Species: |
Human |
| Form: |
Lyophilized. |
| Bio-activity: |
Measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL).
The ED50 for this effect is typically 0.5 ng/ml. |
| AA Sequence: |
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Endotoxin: |
Less than 0.1EU/ug |
| Purity: |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: |
Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: |
Recommemnd working concentration: 0.5ng/ml |
| Gene Name: |
IL12B interleukin 12B [ Homo sapiens (human) ] |
| Official Symbol: |
IL12 |
| Synonyms: |
IL-12A; NFSK; P35; IL-12 subunit p35; IL-12, subunit p35; IL12A; IL12B; NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; p40; IL 12B; IL12; subunit p40; interleukin 12; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin |
| GeneID: |
3593 |
| mRNA Refseq: |
NM_000882.2 |
| Protein Refseq: |
NP_000873 |
| MIM: |
161560 |
| UniProt ID: |
P29459 |
Not For Human Consumption!
