Recombinant Human IL12 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
IL12-158THP Recombinant Human IL12 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  IL12-158THP
Common Name:  IL12
Product Name:  Recombinant Human IL12 protein, GMP Grade
Product Overview:  Recombinant Human IL12 protein GMP Grade(NP_000873) was expressed in HEK293 Cells.
Source:  HEK293 Cells
Species:  Human
Form:  Lyophilized.
Bio-activity:  Measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL).
The ED50 for this effect is typically 0.5 ng/ml.
AA Sequence:  RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Endotoxin:  Less than 0.1EU/ug
Purity:  Greater than 95% as determined by reducing SDS-PAGE.
Storage:  Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution:  Recommemnd working concentration: 0.5ng/ml
Gene Name:  IL12B interleukin 12B [ Homo sapiens (human) ]
Official Symbol:  IL12
Synonyms:  IL-12A; NFSK; P35; IL-12 subunit p35; IL-12, subunit p35; IL12A; IL12B; NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; p40; IL 12B; IL12; subunit p40; interleukin 12; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin
GeneID:  3593
mRNA Refseq:  NM_000882.2
Protein Refseq:  NP_000873
MIM:  161560
UniProt ID:  P29459
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.