| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| IL12-158THP | Recombinant Human IL12 protein, GMP Grade | 10ug | $998 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | IL12-158THP |
| Common Name: | IL12 |
| Product Name: | Recombinant Human IL12 protein, GMP Grade |
| Product Overview: | Recombinant Human IL12 protein GMP Grade(NP_000873) was expressed in HEK293 Cells. |
| Source: | HEK293 Cells |
| Species: | Human |
| Form: | Lyophilized. |
| Bio-activity: | Measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is typically 0.5 ng/ml. |
| AA Sequence: | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Endotoxin: | Less than 0.1EU/ug |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: | Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: | Recommemnd working concentration: 0.5ng/ml |
| Gene Name: | IL12B interleukin 12B [ Homo sapiens (human) ] |
| Official Symbol: | IL12 |
| Synonyms: | IL-12A; NFSK; P35; IL-12 subunit p35; IL-12, subunit p35; IL12A; IL12B; NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; p40; IL 12B; IL12; subunit p40; interleukin 12; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin |
| GeneID: | 3593 |
| mRNA Refseq: | NM_000882.2 |
| Protein Refseq: | NP_000873 |
| MIM: | 161560 |
| UniProt ID: | P29459 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools