- Home
- Products
- Services
- Applications
- Resource
- Company
| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| IL12-4327THP | Recombinant Human IL12 protein, GMP Grade | 10ug | $598 |
|
|
| 500ug | $3998 |
|
|||
| 1mg | $6998 |
|
|||
| Quote Order Bulk Order | |||||
| Cat#: | IL12-4327THP |
| Common Name: | IL12 |
| Product Name: | Recombinant Human IL12 protein, GMP Grade |
| Product Overview: | Recombinant Human IL12 protein GMP Grade(NP_002178) was expressed in CHO cells. |
| Source: | CHO |
| Species: | Human |
| Form: | Lyophilized from sterile PBS, pH7.2. |
| Bio-activity: | Determined by its ability to induce IFN-γ production from NK cells co-stimulated with IL-18. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg. Determined by its ability to increase IFN-γ production by anti-TCR mAb-stimulated PBMCs. The expected ED50 for this effect is 4.0-8.0 ng/ml. |
| Molecular Mass: | 75 kDa |
| Protein length: | HuIL-12 p40: Ile23 - Ser328; Accession # P29460 HuIL-12 p35: Arg23 - Ser219; Accession # P29459 |
| AA Sequence: | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Purity: | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: | IL12A interleukin 12A [ Homo sapiens (human) ] |
| Official Symbol: | IL12 |
| Synonyms: | P35; CLMF; NFSK; NKSF1; IL-12A |
| GeneID: | 3592 |
| mRNA Refseq: | NM_000882.4 |
| Protein Refseq: | NP_000873.2 |
| UniProt ID: | P29459 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
