Recombinant Human IL12 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
IL12-4327THP Recombinant Human IL12 protein, GMP Grade 10ug $598
500ug $3998
1mg $6998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  IL12-4327THP
Common Name:  IL12
Product Name:  Recombinant Human IL12 protein, GMP Grade
Product Overview:  Recombinant Human IL12 protein GMP Grade(NP_002178) was expressed in CHO cells.
Source:  CHO
Species:  Human
Form:  Lyophilized from sterile PBS, pH7.2.
Bio-activity:  Determined by its ability to induce IFN-γ production from NK cells co-stimulated with IL-18. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg.
Determined by its ability to increase IFN-γ production by anti-TCR mAb-stimulated PBMCs. The expected ED50 for this effect is 4.0-8.0 ng/ml.
Molecular Mass:  75 kDa
Protein length:  HuIL-12 p40: Ile23 - Ser328; Accession # P29460
HuIL-12 p35: Arg23 - Ser219; Accession # P29459
AA Sequence:  RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Purity:  ≥ 98% by SDS-PAGE gel and HPLC analyses.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  IL12A interleukin 12A [ Homo sapiens (human) ]
Official Symbol:  IL12
Synonyms:  P35; CLMF; NFSK; NKSF1; IL-12A
GeneID:  3592
mRNA Refseq:  NM_000882.4
Protein Refseq:  NP_000873.2
UniProt ID:  P29459
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.