Cat# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
IL17A-4331THP | Recombinant Human IL17A protein, GMP Grade | 10ug | $998 |
|
|
Quote Order Request a Bulk Order |
Cat#: | IL17A-4331THP |
Common Name: | IL17A |
Product Name: | Recombinant Human IL17A protein, GMP Grade |
Product Overview: | Recombinant Human IL17A protein GMP Grade(NP_002181) was expressed in E. coli. |
Source: | E. coli |
Species: | Human |
Form: | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity: | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 7.5 ng/ml, corresponding to a specific activity of > 1.3 × 10^5 IU/mg. |
Molecular Mass: | Approximately 31.0 kDa, a disulfide-linked homodimer of two 132 amino acid polypeptide chains. |
AA Sequence: | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Endotoxin: | Less than 1 EU/µg determined by LAL method. |
Purity: | Greater than 95 % by SDS-PAGE and HPLC analyses. |
Storage: | This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name: | IL17A interleukin 17A [ Homo sapiens ] |
Official Symbol: | IL17A |
Synonyms: | IL17; CTLA8; IL-17; IL-17A; interleukin-17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8) |
GeneID: | 3605 |
mRNA Refseq: | NM_002190 |
Protein Refseq: | NP_002181 |
MIM: | 603149 |
UniProt ID: | Q16552 |
Catalog# | Product Name | Inquiry |
---|---|---|
EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools