| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| IL17A-4331THP | Recombinant Human IL17A protein, GMP Grade | 10ug | $998 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | IL17A-4331THP |
| Common Name: | IL17A |
| Product Name: | Recombinant Human IL17A protein, GMP Grade |
| Product Overview: | Recombinant Human IL17A protein GMP Grade(NP_002181) was expressed in E. coli. |
| Source: | E. coli |
| Species: | Human |
| Form: | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 7.5 ng/ml, corresponding to a specific activity of > 1.3 × 10^5 IU/mg. |
| Molecular Mass: | Approximately 31.0 kDa, a disulfide-linked homodimer of two 132 amino acid polypeptide chains. |
| AA Sequence: | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Endotoxin: | Less than 1 EU/µg determined by LAL method. |
| Purity: | Greater than 95 % by SDS-PAGE and HPLC analyses. |
| Storage: | This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: | IL17A interleukin 17A [ Homo sapiens ] |
| Official Symbol: | IL17A |
| Synonyms: | IL17; CTLA8; IL-17; IL-17A; interleukin-17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8) |
| GeneID: | 3605 |
| mRNA Refseq: | NM_002190 |
| Protein Refseq: | NP_002181 |
| MIM: | 603149 |
| UniProt ID: | Q16552 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools