Recombinant Human IL17A protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL17A-4331THP |
| Common Name: |
IL17A |
| Product Name: |
Recombinant Human IL17A protein, GMP Grade |
| Product Overview: |
Recombinant Human IL17A protein GMP Grade(NP_002181) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: |
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 7.5 ng/ml, corresponding to a specific activity of > 1.3 × 10^5 IU/mg. |
| Molecular Mass: |
Approximately 31.0 kDa, a disulfide-linked homodimer of two 132 amino acid polypeptide chains. |
| AA Sequence: |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Endotoxin: |
Less than 1 EU/µg determined by LAL method. |
| Purity: |
Greater than 95 % by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL17A interleukin 17A [ Homo sapiens ] |
| Official Symbol: |
IL17A |
| Synonyms: |
IL17; CTLA8; IL-17; IL-17A; interleukin-17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8) |
| GeneID: |
3605 |
| mRNA Refseq: |
NM_002190 |
| Protein Refseq: |
NP_002181 |
| MIM: |
603149 |
| UniProt ID: |
Q16552 |
Not For Human Consumption!
